PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01004.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 63aa    MW: 7201.22 Da    PI: 4.7148
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01004.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.87.8e-181763148
                      NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                             +ppGfrFhPt+eel+++yLkkkv+ ++++l +vi+evd++k+ePw+L+
  Rsa1.0_01004.1_g00016.1 17 VPPGFRFHPTEEELLHYYLKKKVSYEPIDL-DVIREVDLNKLEPWELK 63
                             69****************************.9**************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-18962IPR003441NAC domain
PROSITE profilePS5100520.2271763IPR003441NAC domain
PfamPF023654.1E-81860IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MEIGTSSTVA GGGQLSVPPG FRFHPTEEEL LHYYLKKKVS YEPIDLDVIR EVDLNKLEPW  60
ELK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893123e-73AC189312.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034L08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013652075.12e-37PREDICTED: protein SOMBRERO
RefseqXP_006389872.12e-37hypothetical protein EUTSA_v10019534mg
SwissprotQ9MA171e-37SMB_ARATH; Protein SOMBRERO
TrEMBLA0A078JT112e-37A0A078JT11_BRANA; BnaCnng69540D protein (Fragment)
TrEMBLA0A078JX272e-37A0A078JX27_BRANA; BnaAnng32450D protein
TrEMBLV4KIT32e-37V4KIT3_EUTSA; Uncharacterized protein
STRINGscaffold_202942.19e-37(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79671340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.36e-39NAC family protein